PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NF-YA
Protein Properties Length: 346aa    MW: 37461.8 Da    PI: 9.6288
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936981.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-32195251158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+e+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  XP_010936981.1 195 EEPIYVNAKQYRAILRRRQLRAKMEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 251
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.6E-36193254IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.605194254IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.9E-27196251IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-23197219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-23228251IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MPLNNVKSYD TQHFSNKDSE NTSVRSASNC VDNCPSWLNS SGSHFPQSSY FTNLYMNMDF  60
LAQHGNQIKQ LGGQMPDQDS SSTQSTGQSH QEVSGTSEDN LHEQRVSAQA GNANTCGKRV  120
EGHMKSVLTQ GTPEAAFVTP RLDYSQSFAC VPYPYADPSF VGMLAAYGPH AIIHPQMMGI  180
APSSRVPLPL EPAAEEPIYV NAKQYRAILR RRQLRAKMEA QNKLVKGRKP YLHESRHRHA  240
MKRARGSGGR FLNTKQLQQQ LQPSVSTGLG NVSSSNLHSE NGPVGSSATP AGSDVTSVST  300
SGGMLLGQQD HLGFLSAAFQ SHVRGSTKGG DGMIGNGSQP RITIMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-21195256263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235244RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936981.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_010936983.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLM0SA141e-115M0SA14_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P21730_0011e-114(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-37nuclear factor Y, subunit A3